PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre03.g160600.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family GATA
Protein Properties Length: 788aa    MW: 76721.4 Da    PI: 6.9586
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre03.g160600.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA40.73.3e-1396130135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         C +Cg+t Tp+WRr    nk LCnaCG+++ ++g+
  Cre03.g160600.t1.1  96 CNWCGVTATPQWRRPRGTNKLLCNACGIFFTRYGR 130
                         9************88877777***********996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.8290129IPR000679Zinc finger, GATA-type
SMARTSM004017.5E-690141IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.5E-1094141No hitNo description
Gene3DG3DSA:3.30.50.102.0E-994129IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.96E-1195130No hitNo description
PfamPF003203.9E-1196130IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 788 aa     Download sequence    Send to blast
MGERGDIEAY TRMDRRQALL EVVRLAFEEA GLGLSGSRDD DITSAEAEGP LPTVGARHSS  60
RWRSKEEKLA PPPPAPAPPH RPATGSSSRL VPGGPCNWCG VTATPQWRRP RGTNKLLCNA  120
CGIFFTRYGR LPERSQAHPP PVTVAMPVTV DKLPGAGVAA NTAADSSAHS TEEQPAVHRA  180
PPLEHEAHTA GGAANDDAAE AAAAGATAPT SSSSPVGCSP LKRKDAPQAE AELLKCMEES  240
AADSAAAAAA AAAAVAAATA AAAARPAGTP QQQQQQQQLL PSMLLSHFGH GAFLLPAHAA  300
AQHFLQQMGV AAAAAAPPIA RTASAAAAGA PAPDASGAEA AATAAAAAAG QEAGSAAAAA  360
AAAAAAAAHL MQPEHLQLLL QQQQQQQQQQ QQQQPSLAVA PLDLGLAFAS SLAMHAGLQP  420
HPHPLHQPYL LQQQLVGLAP LPPHLCLSSA AASAAAAAAA SSTNGATTGA PAAAGVSAAP  480
GAASGVPPLS GPAPRAMLPP DFLGRPFSLS ANLLPGGLPP FLDQATATAA AASASAAIAA  540
PSAAAAPRPV YARAAKRHER LPAGDSDDSN VSTDSRATHG DAGGLSHDED DGGTATTATT  600
TTLSTTANTT VSALGLSCSP PALPGLHFSH ALFSRPPASV GVGGAAVAAL PLLSGLSLQG  660
AAAAAAAGGG ARAPVSLGSS VGSGTGAHDS GSGNDGAGSS SSAGVTAAAV AAAVSASASA  720
SGMAGQLKAL SGGAVPPLTF SGAEAALAYG QLPGAAQPFI LLPSRRSKGP RAGGRASSGT  780
PSSSTQS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre03.g160600.t1.1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1148022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.29e-06GATA transcription factor 5